PDB entry 4zz7

View 4zz7 on RCSB PDB site
Description: Crystal structure of methylmalonate-semialdehyde dehydrogenase (DddC) from Oceanimonas doudoroffii
Class: oxidoreductase
Keywords: DddC, OXIDOREDUCTASE
Deposited on 2015-05-22, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7a_
  • Chain 'B':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7b_
  • Chain 'C':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7c_
  • Chain 'D':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7d_
  • Chain 'E':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7e_
  • Chain 'F':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7f_
  • Chain 'G':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7g_
  • Chain 'H':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7h_
  • Chain 'I':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7i_
  • Chain 'J':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7j_
  • Chain 'K':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7k_
  • Chain 'L':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Oceanimonas doudoroffii [TaxId:84158]
    Gene: dddC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz7l_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zz7A (A:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7A (A:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvreg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zz7B (B:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7B (B:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zz7C (C:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7C (C:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zz7D (D:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7D (D:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zz7E (E:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7E (E:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvre
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zz7F (F:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7F (F:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zz7G (G:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7G (G:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4zz7H (H:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7H (H:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4zz7I (I:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7I (I:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvre
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4zz7J (J:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7J (J:)
    ttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntpp
    lkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkge
    hsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpsst
    lyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasangk
    rcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvskm
    tqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnheng
    ffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdgea
    aryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqrw
    psagvre
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4zz7K (K:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7K (K:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4zz7L (L:)
    gshmttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwr
    ntpplkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapel
    lkgehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserd
    psstlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtas
    angkrcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdal
    vskmtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpn
    hengffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftr
    dgeaaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktv
    tqrwpsagvregaefsmptmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz7L (L:)
    mttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntp
    plkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkg
    ehsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpss
    tlyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasang
    krcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvsk
    mtqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnhen
    gffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdge
    aaryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqr
    wpsagvre