Lineage for d4zz7j_ (4zz7 J:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482535Species Oceanimonas doudoroffii [TaxId:84158] [312434] (1 PDB entry)
  8. 2482545Domain d4zz7j_: 4zz7 J: [313116]
    automated match to d4iyma_
    complexed with nad

Details for d4zz7j_

PDB Entry: 4zz7 (more details), 2.9 Å

PDB Description: crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii
PDB Compounds: (J:) Methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4zz7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zz7j_ c.82.1.0 (J:) automated matches {Oceanimonas doudoroffii [TaxId: 84158]}
ttighlingqlvtentrsqnvfnpatgeigkqldlastktveqaisaaqhafptwrntpp
lkrarvmfrfkelleqhadeicrligeehgkiahdamgelqrgienveyacgapellkge
hsrnvgpgidswsefqpmgvvagitpfnfpvmvplwmfpmaivcgncfvlkpserdpsst
lyiaqllqeaglpdgvmnvvngdkeavdallhddrvkavsfvgstpiaeyiyrtasangk
rcqalggaknhaivmpdadmdnavnqllgaafgssgercmalsvavavgdaagdalvskm
tqamqklkvgpstdsgndfgpvitrqhqekvigyinsaeqqgativvdgrqpkvpnheng
ffvggtlidhvtpemtsyqeeifgpvlqvvrvatmqdamdlidaheygngtciftrdgea
aryfsdniqvgmvginiplpvpvayhsfggwkrslfgdlhaygpdavrfytkrktvtqrw
psagvre

SCOPe Domain Coordinates for d4zz7j_:

Click to download the PDB-style file with coordinates for d4zz7j_.
(The format of our PDB-style files is described here.)

Timeline for d4zz7j_: