PDB entry 4trp

View 4trp on RCSB PDB site
Description: Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Class: immune system
Keywords: antibody, immune system
Deposited on 2014-06-17, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of monoclonal antibody against neuroblastoma associated antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TRP (0-End)
  • Chain 'L':
    Compound: Light chain of monoclonal antibody against neuroblastoma associated antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TRP (0-End)
    Domains in SCOPe 2.07: d4trpl1, d4trpl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4trpL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trpL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne