SCOPe 2.08: Domain d4trpl2: 4trp L:114-219

Lineage for d4trpl2 (4trp L:114-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4trpl2: 4trp L:114-219 [274922]
   Other proteins in same PDB: d4trph_, d4trpl1
   automated match to d1t66c2

Details for d4trpl2

PDB Entry: 4trp, 1.25 Å

PDB Description: crystal structure of monoclonal antibody against neuroblastoma associated antigen.

PDB Compounds: (L:) Light chain of monoclonal antibody against neuroblastoma associated antigen

SCOPe Domain Sequences for d4trpl2:

Sequence; same for both SEQRES and ATOM records:

>d4trpl2 b.1.1.2 (L:114-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4trpl2:

• d4trpl2 first appeared in SCOPe 2.05
  
• d4trpl2 appears in SCOPe 2.07