PDB entry 4m0j

View 4m0j on RCSB PDB site
Description: Crystal structure of a D-amino acid aminotransferase from Burkholderia thailandensis E264
Class: transferase
Keywords: NIAID, SSGCID, Structural Genomics, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, D-amino acid aminotransferase, TRANSFERASE
Deposited on 2013-08-01, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid aminotransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0ja_
  • Chain 'B':
    Compound: d-amino acid aminotransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m0jb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m0jA (A:)
    mahhhhhhmsqadiepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaega
    rrapfriaqhlarlarslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvt
    rgvakrghafpanavptvfamasplalptdaqraqgvhcvtaedrrwlhcdiksvsllgn
    vlmaqhaaehdaaetiqlrdgnvtegsssnvwivkngeliapprsnrilegiryalveel
    aeecgirfvareineaelraadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaay
    qrakahemesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0jA (A:)
    iepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaegarrapfriaqhlar
    larslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvtrgvakrghafpan
    avptvfamasplalptdaqraqgvhcvtaedcdiksvsllgnvlmaqhaaehdaaetiql
    rdgnvtegsssnvwivkngeliapprsnrilegiryalveelaeecgirfvareineael
    raadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaayqrakahem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m0jB (B:)
    mahhhhhhmsqadiepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaega
    rrapfriaqhlarlarslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvt
    rgvakrghafpanavptvfamasplalptdaqraqgvhcvtaedrrwlhcdiksvsllgn
    vlmaqhaaehdaaetiqlrdgnvtegsssnvwivkngeliapprsnrilegiryalveel
    aeecgirfvareineaelraadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaay
    qrakahemesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0jB (B:)
    iepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaegarrapfriaqhlar
    larslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvtrgvakrghafpan
    avptvfamasplalptdaqraqgvhcvtaeddiksvsllgnvlmaqhaaehdaaetiqlr
    dgnvtegsssnvwivkngeliapprryalveelaeecgirfvareineaelraadeillt
    satkeilpvtrlddlpvqggrpgpvfdalyaayqrakahem