Lineage for d4m0ja_ (4m0j A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573209Species Burkholderia thailandensis [TaxId:271848] [346411] (2 PDB entries)
  8. 2573210Domain d4m0ja_: 4m0j A: [345338]
    automated match to d5cm0b_
    complexed with ca

Details for d4m0ja_

PDB Entry: 4m0j (more details), 2.05 Å

PDB Description: crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264
PDB Compounds: (A:) d-amino acid aminotransferase

SCOPe Domain Sequences for d4m0ja_:

Sequence, based on SEQRES records: (download)

>d4m0ja_ e.17.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
iepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaegarrapfriaqhlar
larslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvtrgvakrghafpan
avptvfamasplalptdaqraqgvhcvtaedrrwlhcdiksvsllgnvlmaqhaaehdaa
etiqlrdgnvtegsssnvwivkngeliapprsnrilegiryalveelaeecgirfvarei
neaelraadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaayqrakahem

Sequence, based on observed residues (ATOM records): (download)

>d4m0ja_ e.17.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
iepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaegarrapfriaqhlar
larslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvtrgvakrghafpan
avptvfamasplalptdaqraqgvhcvtaedcdiksvsllgnvlmaqhaaehdaaetiql
rdgnvtegsssnvwivkngeliapprsnrilegiryalveelaeecgirfvareineael
raadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaayqrakahem

SCOPe Domain Coordinates for d4m0ja_:

Click to download the PDB-style file with coordinates for d4m0ja_.
(The format of our PDB-style files is described here.)

Timeline for d4m0ja_:

  • d4m0ja_ is new in SCOPe 2.07-stable