PDB entry 4en2
View 4en2 on RCSB PDB site
Description: HIV-1 Nef in complex with MHC-I cytoplasmic domain and Mu1 adaptin subunit of AP1 adaptor (second domain)
Class: viral protein/immune system
Keywords: Human immunodeficiency virus 1, HIV, Nef, MHC-I, antigen presentation, host defense, Adaptor protein complex 1, Mu1 adaptin subunit, sorting motif recognition, CLASP, membrane trafficking, viral hijacking, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on
2012-04-12, released
2012-06-20
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-07-25, with a file datestamp of
2012-07-20.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.21
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: AP-1 complex subunit mu-1
Species: Mus musculus [TaxId:10090]
Gene: Ap1m1, Cltnm
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Protein Nef
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: nef
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Protein Nef
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: nef
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: MHC-I
Species: Homo sapiens [TaxId:9606]
Gene: HLA-2
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: MHC-I
Species: Homo sapiens [TaxId:9606]
Gene: HLA-2
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: AP-1 complex subunit mu-1
Species: Mus musculus [TaxId:10090]
Gene: Ap1m1, Cltnm
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4en2m_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'M':
Sequence, based on SEQRES records: (download)
>4en2M (M:)
swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk
vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli
wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe
nseivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylki
ieksgyqalpwvryitqngdyqlrtq
Sequence, based on observed residues (ATOM records): (download)
>4en2M (M:)
swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk
vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli
wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe
nseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvrylkiieksgyqalp
wvryitqngdyqlrtq