PDB entry 4en2

View 4en2 on RCSB PDB site
Description: HIV-1 Nef in complex with MHC-I cytoplasmic domain and Mu1 adaptin subunit of AP1 adaptor (second domain)
Class: viral protein/immune system
Keywords: Human immunodeficiency virus 1, HIV, Nef, MHC-I, antigen presentation, host defense, Adaptor protein complex 1, Mu1 adaptin subunit, sorting motif recognition, CLASP, membrane trafficking, viral hijacking, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-04-12, released 2012-06-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: AP-1 complex subunit mu-1
  Species: Mus musculus [TaxId:10090]
  Gene: Ap1m1, Cltnm
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35585 (Start-265)
• Chain 'B':
  Compound: Protein Nef
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: nef
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90VU7
• Chain 'C':
  Compound: Protein Nef
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: nef
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90VU7
• Chain 'D':
  Compound: MHC-I
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-2
  Database cross-references and differences (RAF-indexed):
  • PDB 4EN2
• Chain 'E':
  Compound: MHC-I
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-2
  Database cross-references and differences (RAF-indexed):
  • PDB 4EN2 (0-End)
• Chain 'M':
  Compound: AP-1 complex subunit mu-1
  Species: Mus musculus [TaxId:10090]
  Gene: Ap1m1, Cltnm
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35585 (0-265)
  Domains in SCOPe 2.02: d4en2m_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'M':
  Sequence, based on SEQRES records: (download)
  

  >4en2M (M:)
  swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk
  vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli
  wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe
  nseivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylki
  ieksgyqalpwvryitqngdyqlrtq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4en2M (M:)
  swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk
  vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli
  wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe
  nseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvrylkiieksgyqalp
  wvryitqngdyqlrtq