Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) duplication: one domain of this fold is inserted into another domain of the same fold |
Family b.2.7.0: automated matches [195107] (1 protein) not a true family |
Protein automated matches [195108] (1 species) not a true protein |
Species Mus musculus [TaxId:10090] [195109] (1 PDB entry) |
Domain d4en2m_: 4en2 M: [195110] automated match to d2pr9a1 |
PDB Entry: 4en2 (more details), 2.58 Å
SCOPe Domain Sequences for d4en2m_:
Sequence, based on SEQRES records: (download)
>d4en2m_ b.2.7.0 (M:) automated matches {Mus musculus [TaxId: 10090]} swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe nseivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylki ieksgyqalpwvryitqngdyqlrtq
>d4en2m_ b.2.7.0 (M:) automated matches {Mus musculus [TaxId: 10090]} swrsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndk vlfdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpli wiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpe nseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvrylkiieksgyqalp wvryitqngdyqlrtq
Timeline for d4en2m_: