PDB entry 3w2d

View 3w2d on RCSB PDB site
Description: Crystal Structure of Staphylococcal Eenterotoxin B in complex with a novel neutralization monoclonal antibody Fab fragment
Class: immune system
Keywords: Staphylococcal Eenterotoxin B, IMMUNE SYSTEM
Deposited on 2012-11-28, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w2da1, d3w2da2
  • Chain 'H':
    Compound: Monoclonal Antibody 3E2 Fab figment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3W2D (0-222)
  • Chain 'L':
    Compound: Monoclonal Antibody 3E2 Fab figment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3W2D (0-214)
    Domains in SCOPe 2.07: d3w2dl1, d3w2dl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w2dA (A:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w2dA (A:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysiklgnydnv
    rvefknkdladkykdkyvdvfganyyyqcyfskktnrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w2dL (L:)
    envltqspaimsaspgetvtmtcratssvsstylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqyinypltfgggtklelkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec