Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3w2dl2: 3w2d L:131-237 [265586] Other proteins in same PDB: d3w2da1, d3w2da2, d3w2dh_, d3w2dl1 automated match to d2i9la2 complexed with so4 |
PDB Entry: 3w2d (more details), 3.1 Å
SCOPe Domain Sequences for d3w2dl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w2dl2 b.1.1.2 (L:131-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3w2dl2: