PDB entry 3us7

View 3us7 on RCSB PDB site
Description: Crystal Structure of Phytohormone Binding Protein from Medicago truncatula in complex with gibberellic acid (GA3)
Class: Hormone-Binding Protein
Keywords: PR-10 fold, CSBP, plant hormone binding, Cytokinin Specific Binding Protein, Class-10 pathogenesis-related protein, gibberellin, gibberellic acid, GA3, cytokinin, phytohormone, legumes, Hormone-Binding Protein
Deposited on 2011-11-23, released 2012-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.14
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phytohormone Binding Protein
    Species: Medicago truncatula [TaxId:3880]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3US7 (0-End)
    Domains in SCOPe 2.06: d3us7a_
  • Heterogens: GA3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3us7A (A:)
    mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
    giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
    ydheselieekvkptktsestlfylgqlekfllnga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3us7A (A:)
    mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
    giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
    ydheselieekvkptktsestlfylgqlekflln