SCOPe 2.06: Domain d3us7a_: 3us7 A:

Lineage for d3us7a_ (3us7 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [194255] (7 PDB entries)

8. Domain d3us7a_: 3us7 A: [306667]
   automated match to d2flhb_
   complexed with ga3, gol

Details for d3us7a_

PDB Entry: 3us7, 1.34 Å

PDB Description: Crystal Structure of Phytohormone Binding Protein from Medicago truncatula in complex with gibberellic acid (GA3)

PDB Compounds: (A:) Phytohormone Binding Protein

SCOPe Domain Sequences for d3us7a_:

Sequence; same for both SEQRES and ATOM records:

>d3us7a_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
ydheselieekvkptktsestlfylgqlekflln

Timeline for d3us7a_:

• d3us7a_ is new in SCOPe 2.06-stable
  
• d3us7a_ appears in SCOPe 2.07
  
• d3us7a_ appears in the current release, SCOPe 2.08