PDB entry 3r4b

View 3r4b on RCSB PDB site
Description: Crystal Structure of Wild-type HIV-1 Protease in Complex With TMC310911
Class: hydrolase/hydrolase inhibitor
Keywords: drug resistance, drug design, protease inhibitors, AIDS, aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-03-17, released 2011-09-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90K99 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.01: d3r4ba_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90K99 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.01: d3r4bb_
• Heterogens: 74T, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3r4bA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3r4bB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf