PDB entry 3bh6

View 3bh6 on RCSB PDB site
Description: Crystal structure of the RP2-Arl3 complex bound to GppNHp
Class: signaling protein
Keywords: protein-protein complex, gtpase activating protein and gtpase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate, nucleotide-binding, disease mutation, membrane, palmitate, phosphoprotein, sensory transduction, vision, metal binding protein, signaling protein
Deposited on 2007-11-28, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: ARL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUL7 (3-163)
      • engineered (57)
    Domains in SCOPe 2.06: d3bh6a_
  • Chain 'B':
    Compound: Protein XRP2
    Species: Homo sapiens [TaxId:9606]
    Gene: RP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3bh6A (A:)
ggsevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdigglrk
irpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdllta
apaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

    Sequence, based on observed residues (ATOM records): (download) 
    >3bh6A (A:)
evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdigglrkirp
ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

  • Chain 'B':
    No sequence available.