Lineage for d3bh6a_ (3bh6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124256Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries)
  8. 2124262Domain d3bh6a_: 3bh6 A: [208644]
    automated match to d1mr3f_
    complexed with gnp, mg

Details for d3bh6a_

PDB Entry: 3bh6 (more details), 2.6 Å

PDB Description: crystal structure of the rp2-arl3 complex bound to gppnhp
PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d3bh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bh6a_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdigglrkirp
ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

SCOPe Domain Coordinates for d3bh6a_:

Click to download the PDB-style file with coordinates for d3bh6a_.
(The format of our PDB-style files is described here.)

Timeline for d3bh6a_: