SCOPe 2.06: Domain d3bh6a_: 3bh6 A:

Lineage for d3bh6a_ (3bh6 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries)

8. Domain d3bh6a_: 3bh6 A: [208644]
   automated match to d1mr3f_
   complexed with gnp, mg

Details for d3bh6a_

PDB Entry: 3bh6, 2.6 Å

PDB Description: crystal structure of the rp2-arl3 complex bound to gppnhp

PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d3bh6a_:

Sequence; same for both SEQRES and ATOM records:

>d3bh6a_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdigglrkirp
ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

Timeline for d3bh6a_:

• d3bh6a_ first appeared in SCOPe 2.03
  
• d3bh6a_ appears in SCOPe 2.05
  
• d3bh6a_ appears in SCOPe 2.07
  
• d3bh6a_ appears in the current release, SCOPe 2.08