PDB entry 2x5v

View 2x5v on RCSB PDB site
Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre 3 millisecond following photoactivation.
Class: photosynthesis
Keywords: lipidic-sponge phase, photosynthesis, electron transport, cell membrane, metal-binding, transmembrane, formylation, lipoprotein, lipids, transport
Deposited on 2010-02-10, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x5vc_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x5vh1, d2x5vh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x5vl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x5vm_
  • Heterogens: HEM, BCB, BPB, FE2, MQ7, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x5vC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5vC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2x5vH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5vH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveelpypktfvlphggt
    vtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaeraevvdatvdgkakiv
    plrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyfrylelsvagsartal
    iplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsayyaggllyatperae
    sll
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2x5vL (L:)
    mallsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptw
    dpfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpl
    afcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsf
    lfvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasn
    ifltgafgtiasgpfwtrgwpewwgwwldipfws
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5vL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2x5vM (M:)
    madyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaaf
    afgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglf
    mtlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwp
    hidwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdr
    gtaveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkh
    gaapdypaylpatpdpaslpgapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5vM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk