Lineage for d2x5vl_ (2x5v L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579961Protein automated matches [190224] (9 species)
    not a true protein
  7. 2579962Species Blastochloris viridis [TaxId:1079] [187141] (8 PDB entries)
  8. 2579975Domain d2x5vl_: 2x5v L: [244436]
    Other proteins in same PDB: d2x5vc_, d2x5vh1, d2x5vh2
    automated match to d6prcl_
    complexed with bcb, bpb, fe2, hem, mq7

Details for d2x5vl_

PDB Entry: 2x5v (more details), 3 Å

PDB Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre 3 millisecond following photoactivation.
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2x5vl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5vl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d2x5vl_:

Click to download the PDB-style file with coordinates for d2x5vl_.
(The format of our PDB-style files is described here.)

Timeline for d2x5vl_: