PDB entry 2op8

View 2op8 on RCSB PDB site
Description: Crystal Structure of YwhB- Homologue of 4-Oxalocrotonate Tautomerase
Class: isomerase
Keywords: 4-OT, tautomerase, ISOMERASE
Deposited on 2007-01-27, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable tautomerase ywhB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ywhB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70994 (0-60)
  Domains in SCOPe 2.08: d2op8a_
• Chain 'B':
  Compound: Probable tautomerase ywhB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ywhB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70994 (0-60)
  Domains in SCOPe 2.08: d2op8b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2op8A (A:)
  pyvtvkmlegrtdeqkrnlvekvteavkettgaseekivvfieemrkdhyavagkrlsdm
  e
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2op8B (B:)
  pyvtvkmlegrtdeqkrnlvekvteavkettgaseekivvfieemrkdhyavagkrlsdm
  e