SCOPe 2.08: Domain d2op8a_: 2op8 A:

Lineage for d2op8a_ (2op8 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188341] (2 PDB entries)

8. Domain d2op8a_: 2op8 A: [166811]
   automated match to d1otfa_

Details for d2op8a_

PDB Entry: 2op8, 2.5 Å

PDB Description: crystal structure of ywhb- homologue of 4-oxalocrotonate tautomerase

PDB Compounds: (A:) Probable tautomerase ywhB

SCOPe Domain Sequences for d2op8a_:

Sequence; same for both SEQRES and ATOM records:

>d2op8a_ d.80.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
pyvtvkmlegrtdeqkrnlvekvteavkettgaseekivvfieemrkdhyavagkrlsdm
e

Timeline for d2op8a_:

• d2op8a_ first appeared in SCOPe 2.01
  
• d2op8a_ appears in SCOPe 2.07