PDB entry 2nch

View 2nch on RCSB PDB site
Description: Solution structure of translation initiation factor IF1 from wolbachia endosymbiont strain TRS of Brugia malayi
Class: translation
Keywords: translation
Deposited on 2016-03-31, released 2017-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor IF-1
    Species: Wolbachia endosymbiont strain TRS of Brugia malayi [TaxId:292805]
    Gene: infA, Wbm0191
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ncha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nchA (A:)
mvkdeksktlfevegavtallpaaefrvkldneheiichvsgkvrrskiriiigdrvlve
msiydrnakkgriirrlkgtsdrtisk