SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ncha_ (2nch A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052191Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2052192Protein automated matches [190576] (28 species)
    not a true protein
  7. 2289419Species Wolbachia endosymbiont [TaxId:292805] [332720] (1 PDB entry)
  8. 2289420Domain d2ncha_: 2nch A: [332721]
    automated match to d2n3sa_

Details for d2ncha_

PDB Entry: 2nch (more details)

PDB Description: solution structure of translation initiation factor if1 from wolbachia endosymbiont strain trs of brugia malayi
PDB Compounds: (A:) Translation initiation factor IF-1

SCOPe Domain Sequences for d2ncha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ncha_ b.40.4.0 (A:) automated matches {Wolbachia endosymbiont [TaxId: 292805]}
mvkdeksktlfevegavtallpaaefrvkldneheiichvsgkvrrskiriiigdrvlve
msiydrnakkgriirrlkgtsdrtisk

SCOPe Domain Coordinates for d2ncha_:

Click to download the PDB-style file with coordinates for d2ncha_.
(The format of our PDB-style files is described here.)

Timeline for d2ncha_:

  • d2ncha_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06