PDB entry 2naf

View 2naf on RCSB PDB site
Description: Solution structure of peptidyl-tRNA hydrolase from Mycobacterium smegmatis
Class: hydrolase
Keywords: Protein, HYDROLASE
Deposited on 2015-12-23, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_5432, MSMEI_5283, pth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nafa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nafA (A:)
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagtsv
vlakprcymnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftaaeraevptiveqaadatelliaqg
lepaqntvhaw