Lineage for d2nafa_ (2naf A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142123Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2142137Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2142138Protein automated matches [193326] (10 species)
    not a true protein
  7. 2142161Species Mycobacterium smegmatis [TaxId:246196] [225939] (5 PDB entries)
  8. 2142165Domain d2nafa_: 2naf A: [328143]
    automated match to d2lgja_

Details for d2nafa_

PDB Entry: 2naf (more details)

PDB Description: solution structure of peptidyl-trna hydrolase from mycobacterium smegmatis
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2nafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nafa_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagtsv
vlakprcymnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftaaeraevptiveqaadatelliaqg
lepaqntvhaw

SCOPe Domain Coordinates for d2nafa_:

Click to download the PDB-style file with coordinates for d2nafa_.
(The format of our PDB-style files is described here.)

Timeline for d2nafa_: