PDB entry 2l8j

View 2l8j on RCSB PDB site
Description: GABARAPL-1 NBR1-LIR complex structure
Class: signaling protein/protein binding
Keywords: selective autophagy, LC3 proteins, SIGNALING PROTEIN, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2011-01-17, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAPL1, GEC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0R8 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d2l8ja1, d2l8ja2
  • Chain 'B':
    Compound: NBR1-LIR peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14596 (4-16)
      • expression tag (0-3)
      • expression tag (17)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l8jA (A:)
gspefkfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdlt
vgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesvy

  • Chain 'B':
    No sequence available.