Lineage for d2l8ja1 (2l8j A:2-115)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178376Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2178398Protein automated matches [190358] (5 species)
    not a true protein
  7. 2178411Species Human (Homo sapiens) [TaxId:9606] [187279] (26 PDB entries)
  8. 2178472Domain d2l8ja1: 2l8j A:2-115 [242808]
    Other proteins in same PDB: d2l8ja2
    automated match to d3wana_

Details for d2l8ja1

PDB Entry: 2l8j (more details)

PDB Description: gabarapl-1 nbr1-lir complex structure
PDB Compounds: (A:) Gamma-aminobutyric acid receptor-associated protein-like 1

SCOPe Domain Sequences for d2l8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l8ja1 d.15.1.3 (A:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdltvgqfy
flirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesvy

SCOPe Domain Coordinates for d2l8ja1:

Click to download the PDB-style file with coordinates for d2l8ja1.
(The format of our PDB-style files is described here.)

Timeline for d2l8ja1: