PDB entry 1oq6

View 1oq6 on RCSB PDB site
Description: solution structure of Copper-S46V CopA from Bacillus subtilis
Class: hydrolase
Keywords: P-type ATPase, mutation, NMR, folding, Copper complex,, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE
Deposited on 2003-03-07, released 2003-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potential copper-transporting ATPase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yvgX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32220 (0-75)
      • engineered (45)
      • cloning artifact (72)
      • cloning artifact (74-75)
    Domains in SCOPe 2.08: d1oq6a1, d1oq6a2
  • Heterogens: CU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oq6A (A:)
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvviegr