SCOPe 2.08: Domain d1oq6a1: 1oq6 A:1-74

Lineage for d1oq6a1 (1oq6 A:1-74)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species)
   duplication: contains tandem repeat of two HMA domains in the N-terminal region

7. Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries)

8. Domain d1oq6a1: 1oq6 A:1-74 [93414]
   Other proteins in same PDB: d1oq6a2
   domain 1
   complexed with cu

Details for d1oq6a1

PDB Entry: 1oq6

PDB Description: solution structure of copper-s46v copa from bacillus subtilis

PDB Compounds: (A:) Potential copper-transporting ATPase

SCOPe Domain Sequences for d1oq6a1:

Sequence; same for both SEQRES and ATOM records:

>d1oq6a1 d.58.17.1 (A:1-74) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvvie

Timeline for d1oq6a1:

• d1oq6a1 first appeared in SCOP 1.67, called d1oq6a_
  
• d1oq6a1 appears in SCOPe 2.07