PDB entry 1mjv

View 1mjv on RCSB PDB site
Description: DISULFIDE DEFICIENT MUTANT OF VASCULAR ENDOTHELIAL GROWTH FACTOR A (C51A and C60A)
Class: hormone/growth factor
Keywords: cystine-knot growth factor, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2002-08-28, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: -1.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-95)
      • cloning artifact (0)
      • engineered (38)
      • engineered (47)
    Domains in SCOPe 2.07: d1mjva1, d1mjva2
  • Chain 'B':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-95)
      • cloning artifact (0)
      • engineered (38)
      • engineered (47)
    Domains in SCOPe 2.07: d1mjvb1, d1mjvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjvA (A:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjvB (B:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk