Lineage for d1mjva1 (1mjv A:14-108)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2584900Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2584912Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2584915Species Human (Homo sapiens) [TaxId:9606] [57506] (21 PDB entries)
    Uniprot P15692 40-133
  8. 2584964Domain d1mjva1: 1mjv A:14-108 [79214]
    Other proteins in same PDB: d1mjva2, d1mjvb2
    disulfide deficient mutant
    mutant

Details for d1mjva1

PDB Entry: 1mjv (more details), 2.1 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c51a and c60a)
PDB Compounds: (A:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1mjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjva1 g.17.1.1 (A:14-108) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvptee
snitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d1mjva1:

Click to download the PDB-style file with coordinates for d1mjva1.
(The format of our PDB-style files is described here.)

Timeline for d1mjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mjva2