PDB entry 1lfm
View 1lfm on RCSB PDB site
Description: crystal structure of cobalt(III)-substituted cytochrome c (tuna)
Class: electron transport
Keywords: CYTOCHROME C, Folding, Intermediates, ELECTRON TRANSPORT
Deposited on
2002-04-11, released
2002-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cytochrome c
Species: Thunnus thynnus [TaxId:8237]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1lfma_ - Chain 'B':
Compound: cytochrome c
Species: Thunnus thynnus [TaxId:8237]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1lfmb_ - Heterogens: COH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1lfmA (A:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1lfmB (B:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats