Lineage for d1lfma_ (1lfm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980919Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1981024Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
    identical sequence to Thunnus alalunga, TaxId: 8235
  8. 1981026Domain d1lfma_: 1lfm A: [73883]
    complexed with coh

Details for d1lfma_

PDB Entry: 1lfm (more details), 1.5 Å

PDB Description: crystal structure of cobalt(iii)-substituted cytochrome c (tuna)
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1lfma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfma_ a.3.1.1 (A:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOPe Domain Coordinates for d1lfma_:

Click to download the PDB-style file with coordinates for d1lfma_.
(The format of our PDB-style files is described here.)

Timeline for d1lfma_: