PDB entry 1jvi

View 1jvi on RCSB PDB site
Description: the 2.2 angstrom resolution structure of bacillus subtilis luxs/ribosilhomocysteine complex
Class: signaling protein
Keywords: autoinducer synthesis, signaling protein
Deposited on 2001-08-30, released 2001-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Bacillus subtilis [TaxId:1423]
    Gene: luxS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34667 (Start-156)
      • modified residue (83)
      • engineered (95)
    Domains in SCOPe 2.08: d1jvia_
  • Heterogens: ZN, SO4, RHC, HCS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jviA (A:)
mpsvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehll
aftirshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipa
anekqcgqaklhdlegakrlmrfwlsqdkeellkvfg

    Sequence, based on observed residues (ATOM records): (download) 
    >1jviA (A:)
vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
irshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaane
kqcgqaklhdlegakrlmrfwlsqdkeellkvfg