Lineage for d1jvia_ (1jvi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005425Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 3005426Protein Autoinducer-2 production protein LuxS [64295] (5 species)
    S-ribosylhomocysteinase
  7. 3005427Species Bacillus subtilis [TaxId:1423] [64296] (7 PDB entries)
  8. 3005434Domain d1jvia_: 1jvi A: [67348]
    complexed with hcs, rhc, so4, zn

Details for d1jvia_

PDB Entry: 1jvi (more details), 2.2 Å

PDB Description: the 2.2 angstrom resolution structure of bacillus subtilis luxs/ribosilhomocysteine complex
PDB Compounds: (A:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1jvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvia_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis [TaxId: 1423]}
vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
irshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaane
kqcgqaklhdlegakrlmrfwlsqdkeellkvfg

SCOPe Domain Coordinates for d1jvia_:

Click to download the PDB-style file with coordinates for d1jvia_.
(The format of our PDB-style files is described here.)

Timeline for d1jvia_: