![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
![]() | Protein Putative styrene monooxygenase small component [101796] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [101797] (2 PDB entries) |
![]() | Domain d1uscb_: 1usc B: [99861] complexed with act, fmn |
PDB Entry: 1usc (more details), 1.24 Å
SCOPe Domain Sequences for d1uscb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uscb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]} mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
Timeline for d1uscb_: