SCOP 1.67: Domain d1uscb_: 1usc B:

Lineage for d1uscb_ (1usc B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (2 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (4 proteins)
   different dimerization mode than in the PNP-oxidase like family

6. Protein Putative styrene monooxygenase small component [101796] (1 species)

7. Species Thermus thermophilus [TaxId:274] [101797] (2 PDB entries)

8. Domain d1uscb_: 1usc B: [99861]
   complexed with act, fmn

Details for d1uscb_

PDB Entry: 1usc, 1.24 Å

PDB Description: putative styrene monooxygenase small component

SCOP Domain Sequences for d1uscb_:

Sequence; same for both SEQRES and ATOM records:

>d1uscb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

Timeline for d1uscb_:

• d1uscb_ is new in SCOP 1.67
  
• d1uscb_ appears in SCOP 1.69
  
• d1uscb_ appears in the current release, SCOPe 2.08