PDB entry 1usc

View 1usc on RCSB PDB site
Description: putative styrene monooxygenase small component
Class: oxygenase
Keywords: oxygenase, fmn-binding protein, structural genomics, styrene monooxygenase, riken structural genomics/proteomics initiative, rsgi
Deposited on 2003-11-21, released 2003-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.203
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative styrene monooxygenase small component
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USC (0-177)
    Domains in SCOPe 2.03: d1usca_
  • Chain 'B':
    Compound: putative styrene monooxygenase small component
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1USC (0-177)
    Domains in SCOPe 2.03: d1uscb_
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uscA (A:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uscB (B:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap