Lineage for d1uscb_ (1usc B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127290Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1127291Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1127411Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 1127443Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. 1127444Species Thermus thermophilus [TaxId:274] [101797] (2 PDB entries)
  8. 1127446Domain d1uscb_: 1usc B: [99861]
    complexed with act, fmn

Details for d1uscb_

PDB Entry: 1usc (more details), 1.24 Å

PDB Description: putative styrene monooxygenase small component
PDB Compounds: (B:) putative styrene monooxygenase small component

SCOPe Domain Sequences for d1uscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uscb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

SCOPe Domain Coordinates for d1uscb_:

Click to download the PDB-style file with coordinates for d1uscb_.
(The format of our PDB-style files is described here.)

Timeline for d1uscb_: