Lineage for d1upla_ (1upl A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. Family a.118.1.15: Mo25 protein [101407] (2 proteins)
    automatically mapped to Pfam PF08569
    this is a repeat family; one repeat unit is 1upl A:195-240 found in domain
  6. Protein Mo25 protein [101408] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101409] (2 PDB entries)
  8. Domain d1upla_: 1upl A: [99759]

Details for d1upla_

PDB Entry: 1upl (more details), 2.6 Å

PDB Description: crystal structure of mo25 alpha
PDB Compounds: (A:) mo25 protein

SCOPe Domain Sequences for d1upla_:

Sequence, based on SEQRES records: (download)

>d1upla_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}
adivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaqlaq
elynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllk
gyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdll
trhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyisk
penlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqnd
rtedeqfndektylvkqirdlk

Sequence, based on observed residues (ATOM records): (download)

>d1upla_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}
adivknlkesmavlekqkaekateevsknlvamkeilygtnteavaqlaqelynsgllst
lvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllkgyespeialn
cgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdlltrhkllsaef
leqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlklmmnl
lrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqndrtedeqfnde
ktylvkqirdlk

SCOPe Domain Coordinates for d1upla_ are not available.

Timeline for d1upla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uplb_