Lineage for d1uplb_ (1upl B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006773Family a.118.1.15: Mo25 protein [101407] (2 protein domains)
    automatically mapped to Pfam PF08569
  6. 2006774Protein Mo25 protein [101408] (1 species)
  7. 2006775Species Human (Homo sapiens) [TaxId:9606] [101409] (2 PDB entries)
  8. 2006778Domain d1uplb_: 1upl B: [99760]

Details for d1uplb_

PDB Entry: 1upl (more details), 2.6 Å

PDB Description: crystal structure of mo25 alpha
PDB Compounds: (B:) mo25 protein

SCOPe Domain Sequences for d1uplb_:

Sequence, based on SEQRES records: (download)

>d1uplb_ a.118.1.15 (B:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}
spadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaql
aqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfml
lkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkd
lltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyi
skpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfq
ndrtedeqfndektylvkqirdlk

Sequence, based on observed residues (ATOM records): (download)

>d1uplb_ a.118.1.15 (B:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}
spadivknlkesmavleteevsknlvamkeilykepqteavaqlaqelynsgllstlvad
lqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllkgyespeialncgim
lrecirheplakiilwseqfydffryvemstfdiasdafatfkdlltrhkllsaefleqh
ydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlklmmnllrdk
srniqfeafhvfkvfvanpnktqpildillknqaklieflskfqndrtedeqfndektyl
vkqirdlk

SCOPe Domain Coordinates for d1uplb_:

Click to download the PDB-style file with coordinates for d1uplb_.
(The format of our PDB-style files is described here.)

Timeline for d1uplb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1upla_