![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.19: Bubble protein [103565] (1 family) ![]() |
![]() | Family g.3.19.1: Bubble protein [103566] (1 protein) |
![]() | Protein Bubble protein [103567] (1 species) |
![]() | Species Penicillium brevicompactum [TaxId:5074] [103568] (1 PDB entry) |
![]() | Domain d1uoya_: 1uoy A: [99709] |
PDB Entry: 1uoy (more details), 1.5 Å
SCOPe Domain Sequences for d1uoya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uoya_ g.3.19.1 (A:) Bubble protein {Penicillium brevicompactum [TaxId: 5074]} dtcgsgynvdqrrtnsgckagngdrhfcgcdrtgvveckggkwtevqdcgsssckgtsng gatc
Timeline for d1uoya_: