Lineage for d1uoya_ (1uoy A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1241585Superfamily g.3.19: Bubble protein [103565] (1 family) (S)
  5. 1241586Family g.3.19.1: Bubble protein [103566] (1 protein)
  6. 1241587Protein Bubble protein [103567] (1 species)
  7. 1241588Species Penicillium brevicompactum [TaxId:5074] [103568] (1 PDB entry)
  8. 1241589Domain d1uoya_: 1uoy A: [99709]

Details for d1uoya_

PDB Entry: 1uoy (more details), 1.5 Å

PDB Description: the bubble protein from penicillium brevicompactum dierckx exudate.
PDB Compounds: (A:) bubble protein

SCOPe Domain Sequences for d1uoya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uoya_ g.3.19.1 (A:) Bubble protein {Penicillium brevicompactum [TaxId: 5074]}
dtcgsgynvdqrrtnsgckagngdrhfcgcdrtgvveckggkwtevqdcgsssckgtsng
gatc

SCOPe Domain Coordinates for d1uoya_:

Click to download the PDB-style file with coordinates for d1uoya_.
(The format of our PDB-style files is described here.)

Timeline for d1uoya_: