PDB entry 1uoy

View 1uoy on RCSB PDB site
Description: the bubble protein from penicillium brevicompactum dierckx exudate.
Class: exudate protein
Keywords: exudate protein, sulfur phasing, potential killer toxin
Deposited on 2003-09-26, released 2003-11-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bubble protein
  Species: PENICILLIUM BREVICOMPACTUM [TaxId:5074]
  Database cross-references and differences (RAF-indexed):
  • PDB 1UOY (0-63)
  Domains in SCOPe 2.02: d1uoya_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uoyA (A:)
  dtcgsgynvdqrrtnsgckagngdrhfcgcdrtgvveckggkwtevqdcgsssckgtsng
  gatc