Lineage for d1umdd2 (1umd D:188-324)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880667Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 2880671Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 2880696Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)
  8. 2880698Domain d1umdd2: 1umd D:188-324 [99604]
    Other proteins in same PDB: d1umda_, d1umdb1, d1umdc_, d1umdd1
    complexed with coi, mg, tdp

Details for d1umdd2

PDB Entry: 1umd (more details), 1.9 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate
PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1umdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umdd2 c.48.1.2 (D:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

SCOPe Domain Coordinates for d1umdd2:

Click to download the PDB-style file with coordinates for d1umdd2.
(The format of our PDB-style files is described here.)

Timeline for d1umdd2: