SCOPe 2.08: Domain d1umdb1: 1umd B:2-187

Lineage for d1umdb1 (1umd B:2-187)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries)

8. Domain d1umdb1: 1umd B:2-187 [99600]
   Other proteins in same PDB: d1umda_, d1umdb2, d1umdc_, d1umdd2
   complexed with coi, mg, tdp

Details for d1umdb1

PDB Entry: 1umd, 1.9 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate

PDB Compounds: (B:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1umdb1:

Sequence; same for both SEQRES and ATOM records:

>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]}
almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
eevpee

Timeline for d1umdb1:

• d1umdb1 first appeared in SCOP 1.67
  
• d1umdb1 appears in SCOPe 2.07