Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries) |
Domain d1umdd1: 1umd D:2-187 [99603] Other proteins in same PDB: d1umda_, d1umdb2, d1umdc_, d1umdd2 complexed with coi, mg, tdp |
PDB Entry: 1umd (more details), 1.9 Å
SCOPe Domain Sequences for d1umdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umdd1 c.36.1.7 (D:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk eevpee
Timeline for d1umdd1:
View in 3D Domains from other chains: (mouse over for more information) d1umda_, d1umdb1, d1umdb2, d1umdc_ |