Lineage for d1ulna1 (1uln A:1-42)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1700390Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 1700391Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 1700427Protein Lectin-D [103524] (1 species)
    consists of two homologous domains
  7. 1700428Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)
  8. 1700431Domain d1ulna1: 1uln A:1-42 [99569]
    isoform D1

Details for d1ulna1

PDB Entry: 1uln (more details), 1.65 Å

PDB Description: Crystal Structure of Pokeweed Lectin-D1
PDB Compounds: (A:) lectin-D

SCOPe Domain Sequences for d1ulna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulna1 g.3.1.1 (A:1-42) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

SCOPe Domain Coordinates for d1ulna1:

Click to download the PDB-style file with coordinates for d1ulna1.
(The format of our PDB-style files is described here.)

Timeline for d1ulna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulna2