SCOPe 2.04: Domain d1ul3c_: 1ul3 C:

Lineage for d1ul3c_ (1ul3 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (7 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId:1131] [102971] (1 PDB entry)

8. Domain d1ul3c_: 1ul3 C: [99536]
   complexed with ca, gol

Details for d1ul3c_

PDB Entry: 1ul3, 2 Å

PDB Description: Crystal Structure of PII from Synechocystis sp. PCC 6803

PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1ul3c_:

Sequence, based on SEQRES records:

>d1ul3c_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId: 1131]}
mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai

Sequence, based on observed residues (ATOM records):

>d1ul3c_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId: 1131]}
mkkveaiirpfkldevkialvnagivgmtvsevrgfflqklkieivvdegqvdmvvdklv
saartgeigdgkifispvdsvvrirtgekdteai

Timeline for d1ul3c_:

• d1ul3c_ first appeared in SCOP 1.67
  
• d1ul3c_ appears in SCOPe 2.03
  
• d1ul3c_ appears in SCOPe 2.05
  
• d1ul3c_ appears in the current release, SCOPe 2.08