Lineage for d1ul3c_ (1ul3 C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412166Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 412167Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)
  6. 412168Protein PII (product of glnB) [54915] (5 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 412173Species Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId:1131] [102971] (1 PDB entry)
  8. 412176Domain d1ul3c_: 1ul3 C: [99536]

Details for d1ul3c_

PDB Entry: 1ul3 (more details), 2 Å

PDB Description: Crystal Structure of PII from Synechocystis sp. PCC 6803

SCOP Domain Sequences for d1ul3c_:

Sequence, based on SEQRES records: (download)

>d1ul3c_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803}
mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai

Sequence, based on observed residues (ATOM records): (download)

>d1ul3c_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803}
mkkveaiirpfkldevkialvnagivgmtvsevrgfflqklkieivvdegqvdmvvdklv
saartgeigdgkifispvdsvvrirtgekdteai

SCOP Domain Coordinates for d1ul3c_:

Click to download the PDB-style file with coordinates for d1ul3c_.
(The format of our PDB-style files is described here.)

Timeline for d1ul3c_: