Lineage for d1ul3c_ (1ul3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950592Species Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId:1131] [102971] (1 PDB entry)
  8. 2950595Domain d1ul3c_: 1ul3 C: [99536]
    complexed with ca, gol

Details for d1ul3c_

PDB Entry: 1ul3 (more details), 2 Å

PDB Description: Crystal Structure of PII from Synechocystis sp. PCC 6803
PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1ul3c_:

Sequence, based on SEQRES records: (download)

>d1ul3c_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId: 1131]}
mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai

Sequence, based on observed residues (ATOM records): (download)

>d1ul3c_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId: 1131]}
mkkveaiirpfkldevkialvnagivgmtvsevrgfflqklkieivvdegqvdmvvdklv
saartgeigdgkifispvdsvvrirtgekdteai

SCOPe Domain Coordinates for d1ul3c_:

Click to download the PDB-style file with coordinates for d1ul3c_.
(The format of our PDB-style files is described here.)

Timeline for d1ul3c_: