![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) ![]() |
![]() | Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins) |
![]() | Protein Lectin-D [103524] (1 species) consists of two homologous domains |
![]() | Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries) |
![]() | Domain d1uhaa1: 1uha A:1-42 [99395] isoform D2 complexed with ca |
PDB Entry: 1uha (more details), 1.5 Å
SCOPe Domain Sequences for d1uhaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhaa1 g.3.1.1 (A:1-42) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]} apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy
Timeline for d1uhaa1: