PDB entry 1uha

View 1uha on RCSB PDB site
Description: Crystal Structure of Pokeweed Lectin-D2
Class: sugar binding protein
Keywords: lectin, chitin-binding domain, SUGAR BINDING PROTEIN
Deposited on 2003-06-27, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lectin-D2
  Species: Phytolacca americana [TaxId:3527]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83790 (0-81)
  Domains in SCOPe 2.08: d1uhaa1, d1uhaa2
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uhaA (A:)
  apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
  skygwcgysddhcedgcqsqcd